PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.011G054000.1
Common NamePHAVU_011G054000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family FAR1
Protein Properties Length: 277aa    MW: 31191.2 Da    PI: 8.0247
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.011G054000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR192.55.5e-29112199291
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                         fYn+YA++vGF vr+sk ++s+r+g+ + r +vC+keg+r ++k++  k  r+raetr+gC+a+++v+k ++gkw+vtkl++eH+H+l+p
  Phvul.011G054000.1 112 FYNAYATDVGFIVRVSKLSRSRRDGTAIGRALVCNKEGFRMPDKRE--KIVRQRAETRVGCRAMIMVRKVSSGKWVVTKLVKEHTHPLTP 199
                         ******************************************9988..9**************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031015.0E-26112199IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
AVLSVARNRG LKIISGITHR FCHNPNFMEF EIDSTCETVA NAGIGESSSI ADDSREGGSF  60
VEPNYKQDEG DNVPQDSSGI TIPFAIPTVS VVAIEEPYVG QEFETESAAH AFYNAYATDV  120
GFIVRVSKLS RSRRDGTAIG RALVCNKEGF RMPDKREKIV RQRAETRVGC RAMIMVRKVS  180
SGKWVVTKLV KEHTHPLTPG KGRRDFVYEQ FPNEHDKIRE LSQQLATEKR RSATYKRHLE  240
LIFEHIDEHN ESLSKKIQHI VGSVREMETK EEQNKL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007131945.10.0hypothetical protein PHAVU_011G054000g, partial
TrEMBLV7AEH80.0V7AEH8_PHAVU; Uncharacterized protein (Fragment)
STRINGGLYMA12G05600.21e-159(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24533072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.21e-103FAR1 family protein